PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000578193
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 229aa    MW: 25944.1 Da    PI: 7.5936
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000578193genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.6e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l d+++++G+g W+++ +  g++R++k+c++rw +yl
    MDP0000578193 10 KGLWTVEEDRILMDYIREHGKGKWNRVNKVTGLKRCGKSCRLRWMNYL 57
                     678*******************************************97 PP

2Myb_DNA-binding60.82.9e-1963108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eEd+l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l
    MDP0000578193  63 RGDFSEEEDDLIIRLHKLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 108
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.813557IPR017930Myb domain
SuperFamilySSF466891.76E-308104IPR009057Homeodomain-like
SMARTSM007171.9E-12959IPR001005SANT/Myb domain
PfamPF002491.5E-141057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-221164IPR009057Homeodomain-like
CDDcd001671.79E-101357No hitNo description
PROSITE profilePS5129429.43958112IPR017930Myb domain
SMARTSM007173.1E-1862110IPR001005SANT/Myb domain
PfamPF002497.2E-1863108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2765112IPR009057Homeodomain-like
CDDcd001678.90E-1466108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045165Biological Processcell fate commitment
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEGGGNEYKK GLWTVEEDRI LMDYIREHGK GKWNRVNKVT GLKRCGKSCR LRWMNYLSPN  60
VKRGDFSEEE DDLIIRLHKL LGNRWSLIAG RVPGRTDNQV KNHWNTHLSK KLGVNSKKGK  120
TKAKTYPDLE RAKKNSCTPS SNSNSELQPL PNSDSNSNIF GDDEVAAAID GFDDEIMNIK  180
DNNIGTKSGV GFSDMWEAMM IGNDLNLYSS YLLDPTLDDH YPFQFDHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29101127108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374438.11e-170PREDICTED: transcription factor WER-like isoform X1
SwissprotQ9SEI04e-71WER_ARATH; Transcription factor WER
TrEMBLM5WAK51e-116M5WAK5_PRUPE; Uncharacterized protein
STRINGVIT_17s0000g08480.t011e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-72myb domain protein 66